| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Septin-5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Septin-5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Septin-5. This antibody reacts with human. The Septin-5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Septin-5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPE |
|---|
| Other Names | CDCREL, CDCREL1, CDCREL-1, cell division control related protein 1, Cell division control-related protein 1, HCDCREL-1, peanut-like 1, peanut-like 1 (Drosophila), Peanut-like protein 1, platelet glycoprotein Ib beta chain, PNUTL1H5, septin 5, septin-5 |
|---|
| Gene, Accession # | SEPT5, Gene ID: 5413 |
|---|
| Catalog # | NBP2-49407 |
|---|
| Price | |
|---|
| Order / More Info | Septin-5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|