| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ENPP-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ENPP-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENPP-1. This antibody reacts with human. The ENPP-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ENPP-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC |
|---|
| Other Names | ectonucleotide pyrophosphatase/phosphodiesterase 1, E-NPP 1, Ly-41 antigen, M6S1NPP1, Membrane component chromosome 6 surface marker 1, membrane component, chromosome 6, surface marker 1, NPPSalkaline phosphodiesterase 1, PC1, PC-1, PCA1ARHR2, PDNP1ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, plasma-cell membrane glycoprotein 1, Plasma-cell membrane glycoprotein PC-1 |
|---|
| Gene, Accession # | ENPP1, Gene ID: 5167, Accession: P22413, SwissProt: P22413 |
|---|
| Catalog # | NBP2-38945 |
|---|
| Price | |
|---|
| Order / More Info | ENPP-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|