| Edit |   |
|---|
| Antigenic Specificity | ENOX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ENOX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENOX2. This antibody reacts with human. The ENOX2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ENOX2The immunogen for this antibody is ENOX2. (YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE). Peptide sequence YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE. |
|---|
| Other Names | COVA1, Cytosolic ovarian carcinoma antigen 1APK1 antigen, ecto-NOX disulfide-thiol exchanger 2, tNOXAPK1, Tumor-associated hydroquinone oxidase |
|---|
| Gene, Accession # | ENOX2, Gene ID: 10495, Accession: NP_006366, SwissProt: NP_006366 |
|---|
| Catalog # | NBP1-79778-20ul |
|---|
| Price | |
|---|
| Order / More Info | ENOX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|