| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TCEB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCEB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCEB1. This antibody reacts with human. The TCEB1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TCEB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI |
|---|
| Other Names | eloC, Elongin 15 kDa subunit, elongin-C, RNA polymerase II transcription factor SIII subunit C, SIII, SIII p15, transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C), transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C), transcription elongation factor B polypeptide 1, transcription elongation factor B, polypeptide 1 |
|---|
| Gene, Accession # | TCEB1, Gene ID: 6921 |
|---|
| Catalog # | NBP2-58862 |
|---|
| Price | |
|---|
| Order / More Info | TCEB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|