| Edit |   |
| Antigenic Specificity | TCEAL8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TCEAL8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCEAL8. This antibody reacts with human. The TCEAL8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human TCEAL8The immunogen for this antibody is TCEAL8. Peptide sequence PQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELER. |
| Other Names | MGC45400, TCEA-like protein 8, transcription elongation factor A (SII)-like 8, transcription elongation factor A protein-like 8 |
| Gene, Accession # | TCEAL8, Gene ID: 90843, Accession: NP_001006685, SwissProt: NP_001006685 |
| Catalog # | NBP1-79349-20ul |
| Price | |
| Order / More Info | TCEAL8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |