| Edit |   |
|---|
| Antigenic Specificity | TCEAL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCEAL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCEAL2. This antibody reacts with human. The TCEAL2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human TCEAL2The immunogen for this antibody is TCEAL2. Peptide sequence MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENT. |
|---|
| Other Names | my048, MY0876G05, TCEA-like protein 2, transcription elongation factor A (SII)-like 2, transcription elongation factor A protein-like 2, Transcription elongation factor S-II protein-like 2 |
|---|
| Gene, Accession # | TCEAL2, Gene ID: 140597, Accession: NP_525129, SwissProt: NP_525129 |
|---|
| Catalog # | NBP1-79408 |
|---|
| Price | |
|---|
| Order / More Info | TCEAL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|