| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DIO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DIO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIO2. This antibody reacts with human. The DIO2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DIO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERP |
|---|
| Other Names | 5DII, D2, deiodinase, iodothyronine, type II, DIOII, EC 1.97.1, EC 1.97.1.10, ITDI2, SelY, TXDI2thyroxine deiodinase, type II, Type 2 DI, type 2 iodothyronine deiodinase, type II iodothyronine deiodinase, type-II 5'deiodinase, Type-II 5'-deiodinase |
|---|
| Gene, Accession # | DIO2, Gene ID: 1734 |
|---|
| Catalog # | NBP2-56543 |
|---|
| Price | |
|---|
| Order / More Info | DIO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|