| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DIDO1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DIDO1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIDO1. This antibody reacts with human. The DIDO1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DIDO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ |
|---|
| Other Names | BYE1, C20orf158, DATF-1, DATF1DIDO3, death associated transcription factor 1, death inducer-obliterator 1, Death-associated transcription factor 1, death-inducer obliterator 1, DIO1DIDO2, DIO-1hDido1, dJ885L7.8, DKFZp434P1115, FLJ11265, KIAA0333chromosome 20 open reading frame 158, MGC16140 |
|---|
| Gene, Accession # | DIDO1, Gene ID: 11083, Accession: Q9BTC0, SwissProt: Q9BTC0 |
|---|
| Catalog # | NBP2-33269 |
|---|
| Price | |
|---|
| Order / More Info | DIDO1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|