| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLC1. This antibody reacts with human. The KLC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KLC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG |
|---|
| Other Names | hKLC1B, hKLC1G, hKLC1J, hKLC1S, kinesin 2, kinesin 2 60/70kDa, kinesin light chain 1, KLC 1, KLChKLC1N, KNS2AhKLC1P, KNS2hKLC1R, medulloblastoma antigen MU-MB-2.50, MGC15245 |
|---|
| Gene, Accession # | KLC1, Gene ID: 3831, Accession: Q07866, SwissProt: Q07866 |
|---|
| Catalog # | NBP2-33649 |
|---|
| Price | |
|---|
| Order / More Info | KLC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|