| Edit |   |
|---|
| Antigenic Specificity | BBS5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BBS5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BBS5. This antibody reacts with human. The BBS5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BBS5(Bardet-Biedl syndrome 5) The peptide sequence was selected from the middle region of BBS5. Peptide sequence VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW. |
|---|
| Other Names | Bardet-Biedl syndrome 5, Bardet-Biedl syndrome 5 protein, DKFZp762I194 |
|---|
| Gene, Accession # | BBS5, Gene ID: 129880, Accession: Q8N3I7, SwissProt: Q8N3I7 |
|---|
| Catalog # | NBP1-55191 |
|---|
| Price | |
|---|
| Order / More Info | BBS5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|