| Edit |   |
|---|
| Antigenic Specificity | BBS10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BBS10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BBS10. This antibody reacts with human. The BBS10 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BBS10 (Bardet-Biedl syndrome 10) The peptide sequence was selected from the C terminal of BBS10. Peptide sequence SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL. |
|---|
| Other Names | Bardet-Biedl syndrome 10, Bardet-Biedl syndrome 10 protein, FLJ23560C12orf58chromosome 12 open reading frame 58 |
|---|
| Gene, Accession # | BBS10, Gene ID: 79738, Accession: Q8TAM1, SwissProt: Q8TAM1 |
|---|
| Catalog # | NBP1-68993-20ul |
|---|
| Price | |
|---|
| Order / More Info | BBS10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|