| Edit |   |
|---|
| Antigenic Specificity | IPCEF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IPCEF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IPCEF1. This antibody reacts with human. The IPCEF1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET |
|---|
| Other Names | interaction protein for cytohesin exchange factors 1, interactor protein for cytohesin exchange factors 1, KIAA0403interaction protein for cytohesin exchange factors 1 Interaction protein forcytohesin exchange factors 1, phosphoinositide binding protein PIP3-E, Phosphoinositide-binding protein PIP3-E, PIP3-E, RP3-402L9.2 |
|---|
| Gene, Accession # | IPCEF1, Gene ID: 26034 |
|---|
| Catalog # | NBP2-68603 |
|---|
| Price | |
|---|
| Order / More Info | IPCEF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|