| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ago2/eIF2C2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ago2/eIF2C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ago2/eIF2C2. This antibody reacts with human. The Ago2/eIF2C2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Ago2/eIF2C2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI |
|---|
| Other Names | AGO2argonaute 2, argonaute2, EC 3.1.26.n1, EC 3.1.26.n2, eIF2C 2, eIF-2C 2, Eukaryotic translation initiation factor 2C 2, eukaryotic translation initiation factor 2C, 2, hAgo2, MGC3183, PAZ Piwi domain protein, PPD, protein argonaute-2, Protein slicer, Q10 |
|---|
| Gene, Accession # | EIF2C2, Gene ID: 27161 |
|---|
| Catalog # | NBP2-58382 |
|---|
| Price | |
|---|
| Order / More Info | Ago2/eIF2C2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|