| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAPOLG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAPOLG Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAPOLG. This antibody reacts with human. The PAPOLG Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PAPOLG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQLHHYLPAEILQKKKKQSLSDVNRSSGGLQSKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERN |
|---|
| Other Names | EC 2.7.7.19, FLJ11805, FLJ12972, FLJ13482, FLJ14187, MGC133307, MGC133308, neo-PAP, Neo-poly(A) polymerase, nuclear poly(A) polymerase gamma, PAP2, PAPG, PAP-gamma, poly(A) polymerase gamma, Polynucleotide adenylyltransferase gamma, SRP RNA 3' adenylating enzyme/pap2, SRP RNA 3'-adenylating enzyme |
|---|
| Gene, Accession # | PAPOLG, Gene ID: 64895 |
|---|
| Catalog # | NBP2-55534 |
|---|
| Price | |
|---|
| Order / More Info | PAPOLG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|