| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RCBTB1 |
|---|
| Clone | 1E4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | ascites, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RCBTB1 Antibody (1E4) from Novus Biologicals is a mouse monoclonal antibody to RCBTB1. This antibody reacts with human. The RCBTB1 Antibody (1E4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RCBTB1 (NP_060661.3, 2 a.a. 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS |
|---|
| Other Names | Chronic lymphocytic leukemia deletion region gene 7 protein, CLL deletion region gene 7 protein, CLLD7MGC33184, CLLL7, E4.5, FLJ10716, GDP/GTP exchange factor (GEF)-like protein, GLP, RCC1 and BTB domain-containing protein 1, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 1, Regulator of chromosome condensation and BTB domain-containing protein 1, RP11-185C18.1 |
|---|
| Gene, Accession # | RCBTB1, Gene ID: 55213 |
|---|
| Catalog # | H00055213-M07 |
|---|
| Price | |
|---|
| Order / More Info | RCBTB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|