| 产品详情 |
| Edit |   |
| Antigenic Specificity | RCBTB1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RCBTB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RCBTB1. This antibody reacts with human. The RCBTB1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RCBTB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY |
| Other Names | Chronic lymphocytic leukemia deletion region gene 7 protein, CLL deletion region gene 7 protein, CLLD7MGC33184, CLLL7, E4.5, FLJ10716, GDP/GTP exchange factor (GEF)-like protein, GLP, RCC1 and BTB domain-containing protein 1, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 1, Regulator of chromosome condensation and BTB domain-containing protein 1, RP11-185C18.1 |
| Gene, Accession # | RCBTB1, Gene ID: 55213 |
| Catalog # | NBP2-58358 |
| Price | |
| Order / More Info | RCBTB1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|