| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFB11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFB11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFB11. This antibody reacts with human. The NDUFB11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human NDUFB11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE |
|---|
| Other Names | CI-ESSS, complex I NP17.3 subunit, Complex I-ESSS, ESSS, FLJ20494, MGC111182, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, NADH-ubiquinone oxidoreductase ESSS subunit, Neuronal protein 17.3, Np15, Np17.3, P17.3 |
|---|
| Gene, Accession # | NDUFB11, Gene ID: 54539 |
|---|
| Catalog # | NBP1-83956 |
|---|
| Price | |
|---|
| Order / More Info | NDUFB11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|