| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFA8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFA8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFA8. This antibody reacts with human, rat. The NDUFA8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat NDUFA8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCA |
|---|
| Other Names | CI-19KD, CI-PGIV, complex I PGIV subunit, Complex I-19kD, Complex I-PGIV, MGC793, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8, NADH:ubiquinone oxidoreductase PGIV subunit, NADH-ubiquinone oxidoreductase 19 kDa subunit, PGIV |
|---|
| Gene, Accession # | NDUFA8, Gene ID: 4702 |
|---|
| Catalog # | NBP1-82662 |
|---|
| Price | |
|---|
| Order / More Info | NDUFA8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|