| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFA7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFA7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFA7. This antibody reacts with human. The NDUFA7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NDUFA7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL |
|---|
| Other Names | B14.5a, CI-B14.5a, complex I B14.5a subunit, Complex I-B14.5a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5kD, B14.5a), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7, NADH-ubiquinone oxidoreductase subunit B14.5a |
|---|
| Gene, Accession # | NDUFA7, Gene ID: 4701 |
|---|
| Catalog # | NBP2-57928 |
|---|
| Price | |
|---|
| Order / More Info | NDUFA7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|