| Edit |   |
| Antigenic Specificity | GALT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GALT Antibody from Novus Biologicals is a rabbit polyclonal antibody to GALT. This antibody reacts with human. The GALT Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GALT(galactose-1-phosphate uridylyltransferase) The peptide sequence was selected from the C terminal of GALT. Peptide sequence LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET. |
| Other Names | EC 2.7.7.12, Gal-1-P uridylyltransferase, galactose-1-phosphate uridyl transferase, galactose-1-phosphate uridylyltransferase, UDP-glucose--hexose-1-phosphate uridylyltransferase |
| Gene, Accession # | GALT, Gene ID: 2592, Accession: P07902, SwissProt: P07902 |
| Catalog # | NBP1-54980 |
| Price | |
| Order / More Info | GALT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |