| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GALNTL6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GALNTL6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GALNTL6. This antibody reacts with human. The GALNTL6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GALNTL6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN |
|---|
| Other Names | EC 2.4.1.41, GalNAc transferase 17, galNAc-T17, GALNT17Polypeptide GalNAc transferase 17, GaNTase 17, MGC44629, polypeptide N-acetylgalactosaminyltransferase-like 6, pp-GaNTase 17, Protein-UDP acetylgalactosaminyltransferase 17, Putative polypeptide N-acetylgalactosaminyltransferase 17, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 17, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 20, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 6 |
|---|
| Gene, Accession # | GALNTL6, Gene ID: 442117 |
|---|
| Catalog # | NBP1-81845 |
|---|
| Price | |
|---|
| Order / More Info | GALNTL6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|