| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | P2X5/P2RX5 |
|---|
| Clone | 1C5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and RNAi Validation. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The P2X5/P2RX5 Antibody (1C5) from Novus Biologicals is a mouse monoclonal antibody to P2X5/P2RX5. This antibody reacts with human. The P2X5/P2RX5 Antibody (1C5) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | P2RX5 (NP_002552 126 a.a. - 224 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP |
|---|
| Other Names | ATP receptor, ATP receptor subunit, ionotropic ATP receptor P2X5, LRH-1, MGC47755, P2X purinoceptor 5, P2X5lymphoid-restricted histocompatibility antigen-1, P2X5R, Purinergic receptor, purinergic receptor P2X ligand gated ion channel 5, purinergic receptor P2X, ligand-gated ion channel, 5 |
|---|
| Gene, Accession # | P2RX5, Gene ID: 5026, Accession: NP_002552, SwissProt: NP_002552 |
|---|
| Catalog # | H00005026-M01 |
|---|
| Price | |
|---|
| Order / More Info | P2X5/P2RX5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25181038 |
|---|
| 产品资料 |
|
|