| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kv3.3 |
|---|
| Clone | 1C1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kv3.3 Antibody (1C1) from Novus Biologicals is a mouse monoclonal antibody to Kv3.3. This antibody reacts with human, mouse. The Kv3.3 Antibody (1C1) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | KCNC3 (NP_004968 671 a.a. - 757 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP |
|---|
| Other Names | KSHIIID, KV3.3, potassium voltage-gated channel subfamily C member 3, potassium voltage-gated channel, Shaw-related subfamily, member 3, SCA13, Shaw-related voltage-gated potassium channel protein 3, spinocerebellar ataxia 13, voltage-gated potassium channel protein KV3.3, Voltage-gated potassium channel subunit Kv3.3 |
|---|
| Gene, Accession # | KCNC3, Gene ID: 3748, Accession: NP_004968, SwissProt: NP_004968 |
|---|
| Catalog # | H00003748-M01 |
|---|
| Price | |
|---|
| Order / More Info | Kv3.3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18384772 |
|---|
| 产品资料 |
|
|