| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HLA DMA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HLA DMA Antibody from Novus Biologicals is a rabbit polyclonal antibody to HLA DMA. This antibody reacts with human. The HLA DMA Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HLA DMA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENV |
|---|
| Other Names | class II histocompatibility antigen, M alpha chain, D6S222E, DMA, HLA class II histocompatibility antigen, DM alpha chain, major histocompatibility complex, class II, DM alpha, MHC class II antigen DMA, Really interesting new gene 6 protein, RING6HLADM |
|---|
| Gene, Accession # | HLA-DMA, Gene ID: 3108 |
|---|
| Catalog # | NBP2-55086 |
|---|
| Price | |
|---|
| Order / More Info | HLA DMA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|