| Edit |   |
|---|
| Antigenic Specificity | Angiomotin like 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Angiomotin like 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Angiomotin like 1. This antibody reacts with human. The Angiomotin like 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to AMOTL1(angiomotin like 1) The peptide sequence was selected from the N terminal of AMOTL1. Peptide sequence LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE. |
|---|
| Other Names | angiomotin like 1, angiomotin-like protein 1, JEAP, junction-enriched and associated protein |
|---|
| Gene, Accession # | AMOTL1, Gene ID: 154810, Accession: Q8IY63, SwissProt: Q8IY63 |
|---|
| Catalog # | NBP1-55099 |
|---|
| Price | |
|---|
| Order / More Info | Angiomotin like 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|