| Edit |   |
|---|
| Antigenic Specificity | VNN3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VNN3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VNN3. This antibody reacts with human. The VNN3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to VNN3(vanin 3) Antibody(against the N terminal of VNN3. Peptide sequence VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY. |
|---|
| Other Names | HSA238982, MGC171203, vanin 3 |
|---|
| Gene, Accession # | VNN3, Gene ID: 55350, Accession: Q9NY84-2, SwissProt: Q9NY84-2 |
|---|
| Catalog # | NBP1-59753-20ul |
|---|
| Price | |
|---|
| Order / More Info | VNN3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|