| Edit |   |
| Antigenic Specificity | VNN3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VNN3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VNN3. This antibody reacts with human. The VNN3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to VNN3(vanin 3) Antibody(against the N terminal of VNN3. Peptide sequence VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY. |
| Other Names | HSA238982, MGC171203, vanin 3 |
| Gene, Accession # | VNN3, Gene ID: 55350, Accession: Q9NY84-2, SwissProt: Q9NY84-2 |
| Catalog # | NBP1-59753 |
| Price | |
| Order / More Info | VNN3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |