| Edit |   |
| Antigenic Specificity | ZC3H10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZC3H10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZC3H10. This antibody reacts with mouse. The ZC3H10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Zc3h10 - N-terminal. Peptide sequence SEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPP. |
| Other Names | FLJ14451, ZC3HDC10, zinc finger CCCH domain-containing protein 10, zinc finger CCCH-type containing 10, zinc finger CCCH-type domain containing 10 |
| Gene, Accession # | ZC3H10, Gene ID: 84872, Accession: NP_598764 |
| Catalog # | NBP1-98380-20ul |
| Price | |
| Order / More Info | ZC3H10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |