| Edit |   |
|---|
| Antigenic Specificity | ZCCHC5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZCCHC5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZCCHC5. This antibody reacts with human. The ZCCHC5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZCCHC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LEGLIVVETSAASEFPQAPIGLEATDFPLQYTLTFSGDSQKLPEFLVQLYSYMRVRGHLYPTEAALVSFVGNCFSGRAGWWFQLL |
|---|
| Other Names | zinc finger CCHC domain-containing protein 5, Mar3, Mart3, ZHC5, zinc finger, CCHC domain containing 5 |
|---|
| Gene, Accession # | ZCCHC5, Gene ID: 203430, Accession: Q8N8U3, SwissProt: Q8N8U3 |
|---|
| Catalog # | NBP2-30851 |
|---|
| Price | |
|---|
| Order / More Info | ZCCHC5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|