| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC20A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, porcine |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC20A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC20A2. This antibody reacts with human, porcine. The SLC20A2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC20A2(solute carrier family 20 (phosphate transporter), member 2) The peptide sequence was selected from the N terminal of SLC20A2. Peptide sequence DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF. |
|---|
| Other Names | Gibbon ape leukemia virus receptor 2, Glvr-2, GLVR2PIT-2, hPit2, MLVAR, murine leukemia virus, amphotropic, receptor for, Phosphate transporter 2, pit2, PiT-2, sodium-dependent phosphate transporter 2, solute carrier family 20 (phosphate transporter), member 2, Solute carrier family 20 member 2 |
|---|
| Gene, Accession # | SLC20A2, Gene ID: 6575, Accession: Q08357, SwissProt: Q08357 |
|---|
| Catalog # | NBP1-69702 |
|---|
| Price | |
|---|
| Order / More Info | SLC20A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28111052 |
|---|
| 产品资料 |
|
|