| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC20A2 |
|---|
| Clone | 4B1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC20A2 Antibody (4B1) from Novus Biologicals is a mouse monoclonal antibody to SLC20A2. This antibody reacts with human. The SLC20A2 Antibody (4B1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SLC20A2 (NP_006740.1 243 a.a. - 342 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH |
|---|
| Other Names | Gibbon ape leukemia virus receptor 2, Glvr-2, GLVR2PIT-2, hPit2, MLVAR, murine leukemia virus, amphotropic, receptor for, Phosphate transporter 2, pit2, PiT-2, sodium-dependent phosphate transporter 2, solute carrier family 20 (phosphate transporter), member 2, Solute carrier family 20 member 2 |
|---|
| Gene, Accession # | SLC20A2, Gene ID: 6575, Accession: NP_006740, SwissProt: NP_006740 |
|---|
| Catalog # | H00006575-M04 |
|---|
| Price | |
|---|
| Order / More Info | SLC20A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23911649 |
|---|
| 产品资料 |
|
|