| Edit |   |
|---|
| Antigenic Specificity | SLC16A9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC16A9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC16A9. This antibody reacts with human. The SLC16A9 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC16A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHK |
|---|
| Other Names | monocarboxylate transporter 9, C10orf36, MCT9, solute carrier family 16, member 9 (monocarboxylic acid transporter 9) |
|---|
| Gene, Accession # | SLC16A9, Gene ID: 220963, Accession: Q7RTY1, SwissProt: Q7RTY1 |
|---|
| Catalog # | NBP2-31030 |
|---|
| Price | |
|---|
| Order / More Info | SLC16A9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|