| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC16A6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC16A6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC16A6. This antibody reacts with human. The SLC16A6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC16A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL |
|---|
| Other Names | MCT6MCT 6, MCT7MCT 7, Monocarboxylate transporter 6, monocarboxylate transporter 7, solute carrier family 16 (monocarboxylic acid transporters), member 6, Solute carrier family 16 member 6, solute carrier family 16, member 6 (monocarboxylic acid transporter 7) |
|---|
| Gene, Accession # | SLC16A6, Gene ID: 9120, Accession: O15403, SwissProt: O15403 |
|---|
| Catalog # | NBP2-31578 |
|---|
| Price | |
|---|
| Order / More Info | SLC16A6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|