| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC25A12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC25A12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC25A12. This antibody reacts with human. The SLC25A12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC25A12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTK |
| Other Names | AGC1, araceli hiperlarga, ARALAR, ARALAR1, calcium binding mitochondrial carrier superfamily member Aralar1, calcium-binding mitochondrial carrier protein Aralar1, Mitochondrial aspartate glutamate carrier 1, solute carrier family 25 (mitochondrial carrier, Aralar), member 12, Solute carrier family 25 member 12 |
| Gene, Accession # | SLC25A12, Gene ID: 8604, Accession: O75746, SwissProt: O75746 |
| Catalog # | NBP2-38249 |
| Price | |
| Order / More Info | SLC25A12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|