| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC24A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC24A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC24A1. This antibody reacts with human. The SLC24A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC24A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSHQPIKLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAKMIPTTTKNNYSPTAAGTERRKED |
|---|
| Other Names | HsT17412, KIAA0702Na(+)/K(+)/Ca(2+)-exchange protein 1, NCKX, NCKX1Retinal rod Na-Ca+K exchanger, retinal rod Na+/Ca+/K+ exchanger, RODX, sodium/potassium/calcium exchanger 1, solute carrier family 24 (sodium/potassium/calcium exchanger), member 1 |
|---|
| Gene, Accession # | SLC24A1, Gene ID: 9187, Accession: O60721, SwissProt: O60721 |
|---|
| Catalog # | NBP1-92397 |
|---|
| Price | |
|---|
| Order / More Info | SLC24A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|