| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC23A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC23A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC23A2. This antibody reacts with human. The SLC23A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC23A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DKWKCNTTDVSVANGTAELLHTEHIWYPRI |
|---|
| Other Names | KIAA0238SLC23A1, Na(+)/L-ascorbic acid transporter 2, Nucleobase transporter-like 1 protein, Sodium-dependent vitamin C transporter 2, sodium-dependent vitamin C transporter-2, solute carrier family 23 (nucleobase transporters), member 1, solute carrier family 23 (nucleobase transporters), member 2, solute carrier family 23 member 2, SVCT2NBTL1, Yolk sac permease-like molecule 2, YSPL2hSVCT2 |
|---|
| Gene, Accession # | SLC23A2, Gene ID: 9962 |
|---|
| Catalog # | NBP2-13319 |
|---|
| Price | |
|---|
| Order / More Info | SLC23A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30054560 |
|---|
| 产品资料 |
|
|