| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC23A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in the scientific literature (PMID: 30285481). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC23A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC23A1. This antibody reacts with human. The SLC23A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC23A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYI PICPVFKGFSSSSKDQIAIPEDTPENTETAS |
|---|
| Other Names | hSVCT1, SLC23A2, Sodium-dependent vitamin C transporter 1, sodium-dependent vitamin C transporter-1, solute carrier family 23 (nucleobase transporters), member 1, solute carrier family 23 (nucleobase transporters), member 2, solute carrier family 23 member 1, SVCT1Na(+)/L-ascorbic acid transporter 1, Yolk sac permease-like molecule 3, YSPL3MGC22361 |
|---|
| Gene, Accession # | SLC23A1, Gene ID: 9963 |
|---|
| Catalog # | NBP2-13318 |
|---|
| Price | |
|---|
| Order / More Info | SLC23A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30285481 |
|---|
| 产品资料 |
|
|