| Edit |   |
| Antigenic Specificity | MGAT4EP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MGAT4EP Antibody from Novus Biologicals is a rabbit polyclonal antibody to MGAT4EP. This antibody reacts with human. The MGAT4EP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC641515(hypothetical protein LOC641515) The peptide sequence was selected from the C terminal of LOC641515. Peptide sequence FWTHNISIGNHLTVILNHPANLSRVQVMTGSIVEWEVRPGEGAGGAGLPT. |
| Other Names | LOC641515 uncharacterized LOC641515 |
| Gene, Accession # | LOC641515, Gene ID: 641515 |
| Catalog # | NBP1-70608-20ul |
| Price | |
| Order / More Info | MGAT4EP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |