| Edit |   |
|---|
| Antigenic Specificity | MGAT4D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MGAT4D Antibody from Novus Biologicals is a rabbit polyclonal antibody to MGAT4D. This antibody reacts with human. The MGAT4D Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC152586 (glycosyltransferase 54 domain-containing protein) The peptide sequence was selected from the middle region of LOC152586. Peptide sequence KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF. |
|---|
| Other Names | glycosyltransferase 54 domain-containing protein, MGC43429 |
|---|
| Gene, Accession # | LOC152586, Gene ID: 152586, Accession: D6RCD3, SwissProt: D6RCD3 |
|---|
| Catalog # | NBP1-70604-20ul |
|---|
| Price | |
|---|
| Order / More Info | MGAT4D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|