| Edit |   |
|---|
| Antigenic Specificity | MFSD6L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MFSD6L Antibody from Novus Biologicals is a rabbit polyclonal antibody to MFSD6L. This antibody reacts with human. The MFSD6L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MFSD6L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NRVHFPCNGSSGLTSTDALPGVTLPVNITSAQESASSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYLAPSVEGARTTS |
|---|
| Other Names | FLJ35773, major facilitator superfamily domain containing 6-like, major facilitator superfamily domain-containing protein 6-like |
|---|
| Gene, Accession # | MFSD6L, Gene ID: 162387 |
|---|
| Catalog # | NBP1-81967 |
|---|
| Price | |
|---|
| Order / More Info | MFSD6L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|