| 产品详情 |
| Edit |   |
| Antigenic Specificity | LC3A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LC3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to LC3A. This antibody reacts with human. The LC3A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LC3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG |
| Other Names | ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3, LC3A, lc3-i, ii, MAP1A/1B light chain 3 A, MAP1ALC3MAP1A/MAP1B LC3 A, MAP1BLC3MAP1A/MAP1B light chain 3 A, microtubule-associated protein 1 light chain 3 alphaMAP1 light chain 3-like protein 1, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3A |
| Gene, Accession # | MAP1LC3A, Gene ID: 84557 |
| Catalog # | NBP2-54740 |
| Price | |
| Order / More Info | LC3A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|