| Edit |   |
| Antigenic Specificity | LBP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LBP Antibody from Novus Biologicals is a rabbit polyclonal antibody to LBP. This antibody reacts with human. The LBP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LBP(lipopolysaccharide binding protein) The peptide sequence was selected from the middle region of LBP. Peptide sequence LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV. |
| Other Names | lipopolysaccharide binding protein, lipopolysaccharide-binding protein, LPS-binding protein, MGC22233 |
| Gene, Accession # | LBP, Gene ID: 3929, Accession: P18428, SwissProt: P18428 |
| Catalog # | NBP1-58973 |
| Price | |
| Order / More Info | LBP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |