| Edit |   |
| Antigenic Specificity | Breast cancer suppressor candidate 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Breast cancer suppressor candidate 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Breast cancer suppressor candidate 1. This antibody reacts with human. The Breast cancer suppressor candidate 1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Breast cancer suppressor candidate 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGM |
| Other Names | BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein, BCSC1ortholog of mouse AW551984, Breast cancer suppressor candidate 1, LOH11CR2Avon Willebrand factor A domain-containing protein 5A, loss of heterozygosity, 11, chromosomal region 2, gene A, von Willebrand factor A domain containing 5A |
| Gene, Accession # | VWA5A, Gene ID: 4013 |
| Catalog # | NBP2-56919 |
| Price | |
| Order / More Info | Breast cancer suppressor candidate 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |