| Edit |   |
| Antigenic Specificity | MFF |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MFF Antibody from Novus Biologicals is a rabbit polyclonal antibody to MFF. This antibody reacts with human. The MFF Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C2ORF33 The peptide sequence was selected from the C terminal of C2ORF33 (NP_064579). Peptide sequence VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW. |
| Other Names | mitochondrial fission factor |
| Gene, Accession # | MFF, Gene ID: 56947, Accession: Q9GZY8, SwissProt: Q9GZY8 |
| Catalog # | NBP1-70638 |
| Price | |
| Order / More Info | MFF Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |