| Edit |   |
|---|
| Antigenic Specificity | MFAP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MFAP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MFAP4. This antibody reacts with human. The MFAP4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to MFAP4(microfibrillar-associated protein 4) The peptide sequence was selected from the N terminal of MFAP4. Peptide sequence TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK. |
|---|
| Other Names | microfibril-associated glycoprotein 4, microfibrillar-associated protein 4 |
|---|
| Gene, Accession # | MFAP4, Gene ID: 4239, Accession: P55083, SwissProt: P55083 |
|---|
| Catalog # | NBP1-59158 |
|---|
| Price | |
|---|
| Order / More Info | MFAP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|