| Edit |   |
| Antigenic Specificity | CFAP299 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CFAP299 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CFAP299. This antibody reacts with human. The CFAP299 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C4ORF22 The peptide sequence was selected from the N terminal of C4ORF22. Peptide sequence YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT. |
| Other Names | chromosome 4 open reading frame 22, hypothetical protein LOC255119, MGC35043 |
| Gene, Accession # | C4ORF22, Gene ID: 255119, Accession: Q6V702, SwissProt: Q6V702 |
| Catalog # | NBP1-56792 |
| Price | |
| Order / More Info | CFAP299 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |