| Edit |   |
|---|
| Antigenic Specificity | CFAP299 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CFAP299 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CFAP299. This antibody reacts with human. The CFAP299 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C4ORF22 The peptide sequence was selected from the N terminal of C4ORF22. Peptide sequence YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT. |
|---|
| Other Names | chromosome 4 open reading frame 22, hypothetical protein LOC255119, MGC35043 |
|---|
| Gene, Accession # | C4ORF22, Gene ID: 255119, Accession: Q6V702, SwissProt: Q6V702 |
|---|
| Catalog # | NBP1-56792-20ul |
|---|
| Price | |
|---|
| Order / More Info | CFAP299 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|