| Edit |   |
| Antigenic Specificity | CFAP161 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CFAP161 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CFAP161. This antibody reacts with human. The CFAP161 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C15ORF26 The peptide sequence was selected from the C terminal of C15ORF26. Peptide sequence LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV. |
| Other Names | chromosome 15 open reading frame 26, FLJ38615, hypothetical protein LOC161502 |
| Gene, Accession # | C15ORF26, Gene ID: 161502 |
| Catalog # | NBP1-70437 |
| Price | |
| Order / More Info | CFAP161 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |