| 产品详情 |
| Edit |   |
| Antigenic Specificity | GCNF/NR6A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GCNF/NR6A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GCNF/NR6A1. This antibody reacts with human. The GCNF/NR6A1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human GCNF/NR6A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRSVELNGFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLPQQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYA |
| Other Names | GCNF1, GCNFNR61, Germ cell nuclear factor, hGCNF, nuclear receptor subfamily 6 group A member 1, nuclear receptor subfamily 6, group A, member 1, retinoic acid receptor-related testis-associated receptor, Retinoid receptor-related testis-specific receptor, RTRhRTR |
| Gene, Accession # | NR6A1, Gene ID: 2649 |
| Catalog # | NBP2-55277 |
| Price | |
| Order / More Info | GCNF/NR6A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|