| Edit |   |
| Antigenic Specificity | GGN |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GGN Antibody from Novus Biologicals is a rabbit polyclonal antibody to GGN. This antibody reacts with human. The GGN Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GGN(gametogenetin) The peptide sequence was selected from the N terminal of GGN. Peptide sequence GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT. |
| Other Names | FLJ35713, gametogenetin, MGC33369 |
| Gene, Accession # | GGN, Gene ID: 199720, Accession: Q86UU5, SwissProt: Q86UU5 |
| Catalog # | NBP1-53063 |
| Price | |
| Order / More Info | GGN Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |